Comparison

Recombinant human Carcinoembryonic antigen-related cell adhesion molecule 4

Item no. OPCA01222-1MG
Manufacturer AVIVA Systems Biology
Amount 1 mg
Category
Type Proteins Recombinant
Format Liquid
Specific against Human (Homo sapiens)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Citations Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.Kuroki M., Arakawa F., Matsuo Y., Oikawa S., Misumi Y., Nakazato H., Matsuoka Y.J. Biol. Chem. 266:11810-11817(1991)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias carcinoembryonic antigen CGM7;carcinoembryonic antigen gene family member 7;carcinoembryonic antigen related cell adhesion molecule 4;carcinoembryonic antigen-related cell adhesion molecule 4;carcinoembryonic antigen-related cell adhesion molecule 4-sv1;carcinoembryonic antigen-related cell adhesion molecule 4-sv2;CGM7;CGM7_HUMAN;NCA;Nonspecific cross-reacting antigen (NCA);nonspecific cross-reacting antigen W236;non-specific cross-reacting antigen W236.
Available
Manufacturer - Type
Protein
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Molecular Weight
14.7 kDa
Gene symbol
CEACAM4
Gene Fullname
CEA cell adhesion molecule 4
Protein size
Recombinant
Product format
Liquid or Lyophilized powder
Reconstitution and storage
-20°C or -80°C
Description of target
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Protein name
Carcinoembryonic antigen-related cell adhesion molecule 4
Storage Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close