Comparison

MKI67 Recombinant Protein

Item no. OPCD04656-50UG
Manufacturer AVIVA Systems Biology
Amount 50 ug
Category
Type Proteins Recombinant
Applications WB, SDS-PAGE
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag Unconjugated; HIS
Purity > 97%
Sequence Gly3088-Lys3235: GISLRSRRQNKTEAEQQITEVFVLAERIEINRNEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKLEHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias antigen identified by monoclonal antibody Ki-67;antigen Ki67;KIA;MIB-;MIB-1;Molecular Immunology Borstel antibody 1;PPP1R105;proliferation marker protein Ki-67;proliferation-related Ki-67 antigen;protein phosphatase 1,regulatory subunit 105.
Available
Manufacturer - Type
Protein
Manufacturer - Applications
Positive control|Sodium sodecyl sulfate - polyacrylamide gel electrophoresis|Western blot
Manufacturer - Category
Root Catalog/Products/Recombinant Proteins
Manufacturer - Conjugate / Tag
N-terminal His Tag
Molecular Weight
28kDa
Gene symbol
MKI67
Gene Fullname
marker of proliferation Ki-67
Protein size
Recombinant
Product format
Freeze-dried Powder. PBS, pH7.4, containing 0.01% SKL, 5% Trehalose.
Reconstitution and storage
2°C to 8°C|-80°C
Description of target
Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable).
Nucleotide accession_num
NM_001145966.1
Protein accession_num
NP_001139438.1
Protein name
Proliferation marker protein Ki-67
Concentration
200 ug/mL (prior to lyoph)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close