Comparison

Heregulin beta-1, Recombinant, Human

Item no. USB-143361-50UG
Manufacturer United States Biological
Amount 50 ug
Quantity options 10 ug 50 ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against other
Purity ≥98% (SDS-PAGE gel, HPLC). Endotoxin: ≤0.1ng/ug (≤1EU/ug).
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Shipping Condition Cool pack
Available
Manufacturer - Category
Molecular Biology / MB-Growth Factors-Heregulin
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Highly Purified
Form
Supplied as a lyophilized powder. Reconstitute with sterile dH2O, 0.1% BSA or HSA to 0.1-1mg/ml.
EU Commodity Code
30021019
Description
Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-b1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-b1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-b1 (HRG1-b1) is a 7.5kD polypeptide consisting of only the EGF domain of heregulin-b1 (65aa residues).

Recombinant protein corresponding to human Heregulin beta-1, expressed in E. coli

Biological Activity:
The ED50, determined by the dose-dependent stimulation of the proliferation of human MCF-7 cells is <0.5ng/ml.

Specific Activity:
>2x10e6units/mg

Amino Acid Sequence:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Shelf Life
1 year

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close