Comparison

Glucagon Like Peptide-2, Human (GLP-2)

Item no. USB-298174-1MG
Manufacturer United States Biological
Amount 1 mg
Quantity options 100 ug 1 mg
Category
Type Peptides
Format Lyophilized
Specific against other
Purity ≥90% (HPLC)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Cool pack
Available
Manufacturer - Category
Molecular Biology / MB-Hormones, Steroids
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Purified
Form
Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
EU Commodity Code
38220090
Description
Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes.

Source:
Synthetic human Glucagon Like Peptide-2

AA Sequence:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Shelf Life
1 year

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close