Alpha-insect Toxin LqhaIT, Recombinant, Leiurus Quinquestriatus Hebraeus, aa20-85, His-SUMO-Tag

Blue Ice

23, 52

Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.

Alpha toxins bind voltage-independently at site-3 of sodium channels (Nav) and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. The dissociation is voltage-dependent. This toxin is active on insects. It is also highly toxic to crustaceans and has a measurable but low toxicity to mice.

Source:
Recombinant protein corresponding to aa20-85 from Leiurus quinquestriatus hebraeus Alpha-insect toxin LqhaIT, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~23.52kD

Amino Acid Sequence:
VRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCHRK

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.