DODA, Recombinant, Portulaca Grandiflora, aa1-271, His-SUMO-Tag, Myc-Tag (4,5-DOPA Dioxygenase Extradiol)

Blue Ice

49, 9

Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.

Opens the cyclic ring of dihydroxy-phenylalanine (DOPA) between carbons 4 and 5, thus producing an unstable seco-DOPA that rearranges nonenzymatically to betalamic acid.

Source:
Recombinant protein corresponding to aa1-271 from full length Portulaca grandiflora DODA, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli.

Molecular Weight:
~49.9kD

Amino Acid Sequence:
MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRTWDHGTLGYASYKFTSI

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.