MrcA, Recombinant, Neisseria Meningitidis Serogroup B, aa206-413, His-Tag (Penicillin-binding Protein 1A)

Blue Ice

40

Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.

Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits).

Source:
Partial recombinant protein corresponding to aa206-413 from Neisseria meningitidis serogroup B MrcA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~40kD

Amino Acid Sequence:
KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.