ZG16B, Recombinant, Human, aa53-208, His-Tag (Zymogen Granule Protein 16 Homolog B)

Blue Ice

19, 21

Supplied as a liquid in Tris, 50% glycerol.

Source:
Recombinant protein corresponding to aa53-208 from human ZG16B, fused to His-Tag at N-terminal, expressed in Yeast.

Molecular Weight:
~19.21kD

AA Sequence:
GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.