Comparison

TNFR2, His European Partner

Item no. cyt-674-1mg
Manufacturer ProSpec
Amount 1 mg
Quantity options 1 mg 20 ug 5 ug
Category
Type Cytokines and Growth Factors
Format Liquid
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Purity Greater than 95.0% as determined by SDS-PAGE.
Sequence LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSP GQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSC GSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEG CRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFS NTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT.
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias TNFR2,His,Tumor necrosis factor receptor superfamily member 1B,Tumor necrosis factor receptor 2,Tumor necrosis factor receptor type II,p75,p80 TNF-alpha receptor,CD120b,Etanercept,TNF-R2,TNF-RII,TNFR-II,TNFRSF1B,TNFBR,TNFR2,TBPII,TNFR2,TNFR1B,TNFR80,TNF-R75,p75TNFR,TNF-R-II
Similar products TNFR2
Available
Manufacturer - Category
CYTOKINES AND GROWTH FACTORS
Storage Conditions
Store at 4C if entire vial will be used within 2-4 weeks.
Store, frozen at -20C for longer periods of time.
Please avoid freeze thaw cycles.
Description
Recombinant Human Tumor Necrosis Factor Receptor Type 2, His Tag
Formulation
TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.
Introduction
TNFR2 belongs to the TNF-receptor superfamily. TNFR2 is receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. TNFR2 mediates the majority of the metabolic effects of TNF-alpha. In addition, knockout studies in mice propose a role for TNFR2 in protecting neurons from apoptosis by stimulating antioxidative pathways. TNFR2 expression might have a significant role in the angiogenesis, tumor cell proliferation and metastasis of Invasive micropapillary carcinoma of the breast.
There are 2 types of soluble TNF receptors: sTNFR-I and sTNFR-II, which act to neutralize the biological activities of TNF alpha and TNF beta. The levels of these soluble receptors seem to increase as a result of shedding of the extracellular domains of the membrane bound receptors. High levels of soluble TNF receptors are found in the amniotic fluid of pregnant women. TNFR2 and TNFR1 form a heterocomplex which mediates the recruitment of 2 anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. IAPs function in TNF-receptor signaling is unknown, nevertheless, c-IAP1 is believed to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Oxidative stress promotes TNFR1 and TNFR2 self-interaction, ligand-independent and enhanced ligand-dependent TNF signaling. TNF-a, TNFR1 and TNFR2 have roles in cellular differentiation. TNFR1 and TNFR2 function in cell type-specific renal injury.
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Manufacturer - Format
Sterile Filtered clear solution.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close