PON2

Item no.	enz-300-2ug
Manufacturer	ProSpec
Amount	2 ug
Quantity options	10 ug 1 mg 2 ug
Category	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Enzymes
Type	Enzymes
Format	Liquid
Specific against	Human (Homo sapiens)
Purity	Greater than 95% as determined by SDS-PAGE. <br />Single band on Western Blot.
Sequence	MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDID ILPNGLAFFSVGLKFPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNP HGISTFIDNDDTVYLFVVNHPEFKNTVEIFKFEEAENSLLHLKTVKHELLPSVNDIT AVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSAN GINISPDDKYIYVADILAHEIHVL
ECLASS 10.1	32160410
ECLASS 11.0	32160410
UNSPSC	12352204
Alias	PON2,Serum paraoxonase,arylesterase 2,EC 3 1 1 2,EC 3 1 8 1,PON 2,Serum aryldialkylphosphatase 2,A-esterase 2,Aromatic esterase 2
Similar products	PON2
Available
Manufacturer - Category	ENZYMES
Storage Conditions	Store at 4C if entire vial will be used within 1-2 weeks. Store, frozen at -20C for longer periods of time. Avoid multiple freeze-thaw cycles.
Description	Recombinant Human Paraoxonase-2
Formulation	PON2 is supplied in PBS and 50% glycerol.
Introduction	Paraoxonase 2 (PON2) is a member of a multigene family whose genes share 65% identity at the amino acid level, and is expressed in a variety of tissues, including the pancreas. PON2 overexpression has been shown to lower the intracellular oxidative state and reduce the cells ability to oxidize LDL. PON2 is therefore implicated in the modulation of oxidative stress.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Manufacturer - Format	Sterile Filtered clear solution.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

enz-300-2ug-safety-datasheet.pdf