Comparison

UBE2L3 His European Partner

Item no. enz-344-50ug
Manufacturer ProSpec
Amount 50 ug
Quantity options 10 ug 1 mg 50 ug
Category
Type Enzymes
Format Lyophilized
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Purity Greater than 95.0% as determined by(a) Analysis by RP-HPLC.<br />(b) Analysis by SDS-PAGE.
Sequence MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVP DNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAEN WKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFT KKYGEKRPVD.
ECLASS 10.1 32160410
ECLASS 11.0 32160410
UNSPSC 12352204
Alias UBE2L3 His,Ubiquitin-conjugating enzyme E2 L3,EC 6 3 2 19,Ubiquitin-protein ligase L3,Ubiquitin carrier protein L3,UbcH7,E2-F1,L-UBC,UbcM4
Similar products UBE2L3 His
Available
Manufacturer - Category
ENZYMES
Storage Conditions
Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2L3 should be stored at 4C between 2-7 days and for future use below -18C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Description
Recombinant Human Ubiquitin-Conjugating Enzyme E2L 3, His Tag
Formulation
Lyophilized from a 0.2m filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5.
Introduction
Human Ubquitin Conjugating Enzyme 7 (UbcH7) is a class I enzyme which functions in the stress response and the control of transcription factors. The enzyme is ubiquitously expressed with high levels of expression seen in adult muscle. UbcH7 mediates the selective degradation of short-lived and abnormal proteins and is highly homologous to UbcH5. It has been demonstrated to participate in the ubiquitinylation of p53, c-Fos and NF-B. UbcH7 is one of two E2s (UbcH5 being the other) with which HECT domain proteins interact with UbcH7 being able to efficiently substitute for UbcH5 in E6-AP-dependent ubiquitinylation.
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Manufacturer - Format
Sterile Filtered white lyophilized powder.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close