Comparison

mIL17E European Partner

Item no. cyt-641-1mg
Manufacturer ProSpec
Amount 1 mg
Quantity options 1 mg 25 ug 5 ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Purity Greater than 95.0% as determined by:<BR>(a) Analysis by RP-HPLC.<BR>(b) Analysis by SDS-PAGE.
Sequence VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVS PPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRD LNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPL YHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACV CVRPRVMA.
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias mIL17E,IL-25,IL-17E,IL17E,IL25,Interleukin-25
Similar products mIL 17E
Available
Manufacturer - Category
CYTOKINES AND GROWTH FACTORS
Storage Conditions
Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution IL17E should be stored at 4C between 2-7 days and for future use below -18C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Description
Recombinant Mouse Interleukin-17E
Formulation
IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Introduction
IL-25 also called IL-17E cytokine has a sequence similarity with IL17.
IL-17E indluces NF-kappaB activation, and stimulates the production of IL-8. IL17E and IL17B are ligands for the cytokine receptor IL17BR. IL-25 is a proinflammatory cytokine favoring Th2-type immune response. The upregulation of costimulation-induced IL-17E receptors and release of cytokines and chemokines from IL-17E treated costimulated Th cells are differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity. Blocking Iinterleukin-25 prevents airway hyperresponsiveness, a critical feature of clinical asthma. IL25 produced by innate effector eosinophils and basophils increase the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells. Over expression of IL-25 up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model. IL-25 contributes to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts which supports the fact that IL-17E is an important factor in asthma pathophysiology. IL-17E operates by amplifying TH2 cell-mediated allergic airway inflammation but doesnt induce allergic inflammation in vivo.
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Biological Activity
The activity is determined by the dose-dependent production of IL-8 by human PBMCs and is 322-488ng/ml.
Manufacturer - Format
Sterile Filtered White lyophilized (freeze-dried) powder.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close