« Back
Home /
Recombinant Human Pyridoxal phosphate phosphatase (PDXP)

Recombinant Human Pyridoxal phosphate phosphatase (PDXP)

Manufacturer	Biomatik
Category	Neuroscience Neural Lineage Markers Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins Neuronal Cell Markers
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC20594-50ug
Targets	PDXP;;PLP1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	PDXP
Alternative Names	PLP phosphatase Alternative name(s): Chronophin
Uniprot	Q96GD0
Source	Baculovirus
Expression Region	1-296aa
AA Sequence	MARCERLRGAALRDVLGRAQGVLFDCDGVLWNGER AVPGAPELLERLARAGKAALFVSNNSRRARPELAL RFARLGFGGLRAEQLFSSALCAARLLRQRLPGPPD APGAVFVLGGEGLRAELRAAGLRLAGDPSAGDGAA PRVRAVLVGYDEHFSFAKLREACAHLRDPECLLVA TDRDPWHPLSDGSRTPGTGSLAAAVETASGRQALV VGKPSPYMFECITENFSIDPARTLMVGDRLETDIL FGHRCGMTTVLTLTGVSRLEEAQAYLAAGQHDLVP HYYVESIADLTEGLED
Sequence Info	Full Length
Tag Info	C-terminal 9xHis-tagged
Theoretical MW	33.7 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine. Pyridoxal phosphate phosphatase. Has some activity towards pyridoxal 5'-phosphate (PLP), pyridoxine 5'-phosphate (PMP) and pyridoxine 5'-phosphate (PNP), with a highest activity with PLP followed by PNP.2 Publications.
Function	Protein serine phosphatase that dephosphorylates 'Ser-3' in cofilin and probably also dephosphorylates phospho-serine residues in DSTN. Regulates cofilin-dependent actin cytoskeleton reorganization. Required for normal progress through mitosis and normal cytokinesis. Does not dephosphorylate phospho-threonines in LIMK1. Does not dephosphorylate peptides containing phospho-tyrosine
Subcellular location	Cytoplasm, cytosol, Cytoplasm, cytoskeleton, Cell projection, ruffle membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side
Protein Families	HAD-like hydrolase superfamily
Tissue Specificity	Ubiquitously expressed (at protein level) (PubMed:23223568). Highly expressed in all the regions of central nerve system except the spinal cord. Also expressed at high level in liver and testis. In fetus, it is weakly expressed in all organs except brain (PubMed:14522954, PubMed:15580268).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024