« Back
Home /
Recombinant Human Beta-2 adrenergic receptor (ADRB2)

Recombinant Human Beta-2 adrenergic receptor (ADRB2)

Item no.	BM-RPC20707-100ug
Manufacturer	Biomatik
Amount	100 UG
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity Cardiovascular Research Heart Failure Myocardial Infarction Hypertension Arrhythmias
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Sequence	MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVG MGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNY FITSLACADLVMGLAVVPFGAAHILMKMWTFGNFW CEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFK YQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYR ATHQEAINCYANETCCDFFTNQAYAIASSIVSFYV PLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNL SQV
Protein Family	G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB2 sub-subfamily
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Beta-2 adrenoreceptor Short name: Beta-2 adrenoceptor
Similar products	Beta-2 adrenoreceptor Short name: Beta-2 adrenoceptor
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Shipping Temperature	Ice packs
Storage Conditions	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Molecular Weight (Theoretical)	62.5 kDa
Expression Region	1-413aa
Restrictions	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Expiration	1 year
Endotoxin	Not Tested
Relevance	Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Subcellular location	Cell membrane, Multi-pass membrane protein, Early endosome
Function	Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine.
Activity	Not Tested
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Pathway	Calciumsignalingpathway
Manufacturer - Gene Name	ADRB2
Sequence Information	Full Length of BC063486

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 UG

available

Delivery expected until 2/12/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer