« Back
Home /
Recombinant Human Claudin-6 (CLDN6), partial

Recombinant Human Claudin-6 (CLDN6), partial

Manufacturer	Biomatik
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Amount	100ug
Item no.	BM-RPC20717-100ug
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	CLDN6
Alternative Names	Skullin
Uniprot	P56747
Source	in vitro E.coli expression system
Expression Region	1-82aa
AA Sequence	MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAF IGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSL LALPQDLQAARA
Sequence Info	Partial
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	24.8 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Plays a major role in tight junction-specific obliteration of the intercellular space (By similarity). May act as a coreceptor for HCV entry into hepatic cells.
Function	Plays a major role in tight junction-specific obliteration of the intercellular space.
Subcellular location	Cell junction, tight junction, Cell membrane, Multi-pass membrane protein
Protein Families	Claudin family
Tissue Specificity	Expressed in the liver, in peripheral blood mononuclear cells and hepatocarcinoma cell lines.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/28/2024