« Back
Home /
Recombinant Human Diacylglycerol O-acyltransferase 1 (DGAT1), partial

Recombinant Human Diacylglycerol O-acyltransferase 1 (DGAT1), partial

Manufacturer	Biomatik
Category	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Obesity Enzymes Fatty Acid Synthesis
Type	Proteins Recombinant
Specific against	Human
Amount	100ug
Item no.	BM-RPC20725-100ug
Targets	DGAT2
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	DGAT1
Alternative Names	ACAT-related gene product 1 Acyl-CoA retinol O-fatty-acyltransferase Short name:ARAT Short name: Retinol O-fatty-acyltransferase Diglyceride acyltransferase AGRP1, DGAT
Uniprot	O75907
Source	in vitro E.coli expression system
Expression Region	240-488aa
AA Sequence	TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIR KRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMK PFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHS CLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNI PVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFF HEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQ GNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAP AAEA
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	37.1 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Function	Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Involvement in disease	Diarrhea 7 (DIAR7)
Subcellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Protein Families	Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024