« Back
Home /
Recombinant Human Bone marrow proteoglycan (PRG2), partial

Recombinant Human Bone marrow proteoglycan (PRG2), partial

Manufacturer	Biomatik
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Bone Cancer
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC20747-50ug
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	PRG2
Alternative Names	Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name(s): Pregnancy-associated major basic protein
Uniprot	P13727
Source	in vitro E.coli expression system
Expression Region	106-222aa
AA Sequence	TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWV DGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA HCLRRLPFICSY
Sequence Info	Partial
Tag Info	N-terminal 6xHis-SUMO-tagged
Theoretical MW	29.8 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Function	Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activity of PAPPA.
Subcellular location	Bone marrow proteoglycan: Secreted, Note=The proform is secreted, SUBCELLULAR LOCATION: Eosinophil granule major basic protein: Cytoplasmic vesicle, secretory vesicle
Tissue Specificity	High levels of the proform in placenta and pregnancy serum; in placenta, localized to X cells of septa and anchoring villi. Lower levels in a variety of other tissues including kidney, myometrium, endometrium, ovaries, breast, prostate, bone marrow and colon.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024