« Back
Home /
Recombinant Mouse Interleukin-23 subunit alpha (Il23a)

Recombinant Mouse Interleukin-23 subunit alpha (Il23a)

Manufacturer	Biomatik
Category	Oncology By Cell Type Blastoma Carcinoma Glioma Hematology Leukemia Lymphoma Myeloma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Mesothelioma Senescence By Organ Lung Cancer
Type	Proteins Recombinant
Specific against	Mouse
Amount	100ug
Item no.	BM-RPC20830-100ug
Targets	CDKN2A
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	Il23a
Alternative Names	Interleukin-23 subunit p19 Short name: IL-23p19
Uniprot	Q9EQ14
Source	in vitro E.coli expression system
Expression Region	22-196aa
AA Sequence	VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNL LREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCL QRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLH TSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPL LRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	23.7 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Function	Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Subcellular location	Secreted
Protein Families	IL-6 superfamily
Tissue Specificity	Secreted by activated dendritic cells (at protein level). Detected in various tissues with higher expression in polarized Th1 cells and activated macrophages.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 5/30/2024