« Back
Home /
Recombinant Human C-X-C motif chemokine 10 (CXCL10)

Recombinant Human C-X-C motif chemokine 10 (CXCL10)

Manufacturer	Biomatik
Category	Oncology Neuroscience Neuroinflammation By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC23816-50ug
Targets	CD203c;;CXCL10;;IFNG
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	CXCL10
Alternative Names	10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10 Small-inducible cytokine B10
Uniprot	P02778
Source	Mammalian cell
Expression Region	22-98aa
AA Sequence	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQF CPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK ERSKRSP
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	12.6 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Function	Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3.
Subcellular location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024