« Back
Home /
Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

Recombinant Human Glucagon-like peptide 1 receptor (GLP1R), partial

Manufacturer	Biomatik
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC23823-50ug
Targets	GCG ;;GLP1R
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	GLP1R
Alternative Names	GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R
Uniprot	P43220
Source	Mammalian cell
Expression Region	24-145aa
AA Sequence	RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPAT DLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWAS SVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE SKRGERSSPEEQLLFLY
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	18.3 kDa
Purity	>90% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Function	G-protein coupled receptor for glucagon-like peptide 1 (GLP-1)
Subcellular location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 2 family
Paythway	cAMPsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024