« Back
Home /
Recombinant Mouse Group XV phospholipase A2 (Pla2g15)

Recombinant Mouse Group XV phospholipase A2 (Pla2g15)

Manufacturer	Biomatik
Category	Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins Cardiovascular Research Thrombosis & Hemostasis Enzymes Fatty Acid Catabolism
Type	Proteins Recombinant
Specific against	Mouse
Amount	1mg
Item no.	BM-RPC25613-1mg
Targets	PLA2G1B
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	Pla2g15
Alternative Names	1-O-acylceramide synthase1 Short name: ACS LCAT-like lysophospholipase Short name: LLPL Lysophospholipase 3 Lysosomal phospholipase A22 Short name: LPLA2
Uniprot	Q8VEB4
Source	E.coli
Expression Region	34-412aa
AA Sequence	AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKK TDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSR ATQFPDGVDVRVPGFGETFSMEFLDPSKRNVGSYF YTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPY FLALREMIEEMYQMYGGPVVLVAHSMGNVYMLYFL QRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVLASG DNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSH EKVFVYTPTTNYTLRDYHRFFRDIGFEDGWFMRQD TEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFP DRDPKICFGDGDGTVNLESVLQCQAWQSRQEHRVS LQELPGSEHIEMLANATTLAYLKRVLLEP
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	50.5 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid. Has high activity with 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC) and 1, 2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), catalyzing the transfer of oleic acid to N-acetyl-sphingosine. Required for normal phospholipid degradation in alveolar and peritoneal macrophages and in spleen
Function	Has transacylase and calcium-independent phospholipase A2 activity. Catalyzes the formation of 1-O-acyl-N-acetylsphingosine and the concomitant release of a lyso-phospholipid
Subcellular location	Secreted, Lysosome, Membrane, Peripheral membrane protein
Protein Families	AB hydrolase superfamily, Lipase family
Tissue Specificity	Detected in blood plasma (PubMed:20410020). Detected in alveolar macrophages (at protein level) (PubMed:16106046, PubMed:16880524, PubMed:19017977). Detected in heart, liver, spleen, kidney, thymus, brain and lung (PubMed:16880524).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 6/27/2024