« Back
Home /
Recombinant Human Interleukin-5 (IL5)

Recombinant Human Interleukin-5 (IL5)

Manufacturer	Biomatik
Category	Oncology Metabolism Diabetes Glucose Homeostasis By Cell Type Carcinoma Hematology Leukemia Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC25912-50ug
Targets	IL5 ;; IL6
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	IL5
Alternative Names	B-cell differentiation factor I Eosinophil differentiation factor T-cell replacing factor Short name: TRF
Uniprot	P05113
Source	Yeast
Expression Region	20-134aa
AA Sequence	IPTEIPTSALVKETLALLSTHRTLLIANETLRIPV PVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFK NLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLG VMNTEWIIES
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 6xHis-tagged
Theoretical MW	15.1 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Function	Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Subcellular location	Secreted
Protein Families	IL-5 family
Paythway	Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024