Comparison

Recombinant Measles virus Nucleoprotein (N), partial

Item no. BM-RPC25937-100ug
Manufacturer Biomatik
Amount 100 UG
Category
Type Proteins Recombinant
Specific against Virus
Host E.coli
Conjugate/Tag Unconjugated
Purity >85% by SDS-PAGE
Sequence MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFGNKEISDIEVQDPEGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPGNKPRIAEMIC
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Nucleocapsid proteinNPProtein N
Similar products Nucleocapsid protein Short name: NP Short name: Protein N
Shipping Condition Cool pack
Available
Specificity Measles virus (strain Edmonston-Schwarz vaccine)(MeV)(Subacute sclerose panencephalitis virus)
Manufacturer - Category
Protein
Manufacturer - Targets
N
Manufacturer - Conjugate / Tag
Unconjugated, N-Terminal 10Xhis-Tagged
Shipping Temperature
Ice packs
Storage Conditions
-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)
49.9kDa
Protein Length
Partial
Protein Type
Recombinant Protein
Expression Region
1~400aa
Restrictions
For Research Use Only. Not for use in diagnostic procedures.
Expiration
12 months
Reconstitution
Refer to the datasheet/CoA included in the product pouch.
Endotoxin
Not Tested
Quality Systems
This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description
Recombinant Measles virus Nucleoprotein (N), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Measles virus (strain Edmonston-Schwarz vaccine) (MeV) (Subacute sclerose panencephalitis virus). Target Name: N. Target Synonyms: Nucleocapsid proteinNPProtein N. Accession Number: B8PZP3. Expression Region: 1~400aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 49.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description
Recombinant Measles virus Nucleoprotein (N), partial is a purified Recombinant Protein.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Activity
Not Tested

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 UG
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close