« Back
Home /
Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial

Recombinant Human Oligodendrocyte transcription factor 1 (OLIG1), partial

Manufacturer	Biomatik
Category	Oncology Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Signaling Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer Neuronal Cell Markers
Type	Proteins Recombinant
Specific against	Human
Amount	50ug
Item no.	BM-RPC25946-50ug
Targets	HNF1A;;OLIG1
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	OLIG1
Alternative Names	Class B basic helix-loop-helix protein 6 Short name: bHLHb6 Class E basic helix-loop-helix protein 21 Short name: bHLHe21
Uniprot	Q8TAK6
Source	Yeast
Expression Region	17-105aa
AA Sequence	MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSS TSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGS GAHPGGSARPDAKEEQQQQ
Sequence Info	Partial
Tag Info	N-terminal 6xHis-tagged
Theoretical MW	11.1 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube
Function	Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).
Subcellular location	Nucleus
Tissue Specificity	Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024