« Back
Home /
Recombinant Mouse C-type lectin domain family 12 member A (Clec12a), partial

Recombinant Mouse C-type lectin domain family 12 member A (Clec12a), partial

Manufacturer	Biomatik
Category	Oncology By Cell Type Hematology Leukemia Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse
Amount	50ug
Item no.	BM-RPC26029-50ug
Targets	CLEC12A
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	Clec12a
Alternative Names	C-type lectin-like molecule 1(CLL-1) (Myeloid inhibitory C-type lectin-like receptor) (MICL) (Micl)
Uniprot	Q504P2
Source	E.coli
Expression Region	65-267aa
AA Sequence	YTTLATEMIKSNQLQRAKEELQENVFLQLKHNLNS SKKIKNLSAMLQSTATQLCRELYSKEPEHKCKPCP KGSEWYKDSCYSQLNQYGTWQESVMACSARNASLL KVKNKDVLEFIKYKKLRYFWLALLPRKDRTQYPLS EKMFLSEESERSTDDIDKKYCGYIDRVNVYYTYCT DENNIICEETASKVQLESVLNGLPEDSR
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	30.8 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Cell surface receptor that modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.
Function	Cell surface receptor that modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.
Subcellular location	Cell membrane, Single-pass type II membrane protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 6/27/2024