Recombinant Human Apolipoprotein C-I (APOC1)

Apolipoprotein C1 (Apo-CI) (ApoC-I)

E.coli

TPDVSSALDKLKEFGNTLEDKARELISRIKQSELS AKMREWFSETFQKVKEKLKIDS

N-terminal 6xHis-SUMO-tagged

>85% as determined by SDS-PAGE.

Not tested

Ice packs

1 year

Inhibitor of lipoprotein binding to the low density lipoprotein receptor, LDL receptor-related protein, and very low density lipoprotein receptor. Associates with high density lipoproteins and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein. Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.