Comparison

Recombinant Human AT-rich interactive domain-containing protein 1A (ARID1A), partial

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26317-50ug
Targets ARID1A
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
ARID1A
Alternative Names
B120 BRG1-associated factor 250 Short name: BAF250 BRG1-associated factor 250a Short name: BAF250A Osa homolog 1 Short name: hOSA1 SWI-like protein SWI/SNF complex protein p270 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 hELD C1orf4, OSA1, SMARCF1
Uniprot
O14497
Source
Baculovirus
Expression Region
1976-2231aa
AA Sequence
SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLI LGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNK VEWWWDCLEMLRENTLVTLANISGQLDLSPYPESI CLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQ RLVLETLSKLSIQDNNVDLILATPPFSRLEKLYST MVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAI AVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQN PPFEPTSVDMM
Sequence Info
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW
32.4 kDa
Purity
>85% as determined by SDS-PAGE.
Storage Buffer
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level
Not tested
Biological Activity
Not tested
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth
Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).
Involvement in disease
Coffin-Siris syndrome 2 (CSS2)
Subcellular location
Nucleus
Tissue Specificity
Highly expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon, and PBL, and at a much lower level in heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Delivery expected until 6/27/2024 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close