« Back
Home /
Recombinant Mouse 17-beta-hydroxysteroid dehydrogenase 13 (Hsd17b13)

Recombinant Mouse 17-beta-hydroxysteroid dehydrogenase 13 (Hsd17b13)

Item no.	BM-RPC26382-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Alcohol dehydrogenase PAN1B-like (Short-chain dehydrogenase/reductase 9) (17-beta-HSD 13) (Scdr9)
Similar products	Alcohol dehydrogenase PAN1B-like (Short-chain dehydrogenase/reductase 9) (17-beta-HSD 13) (Scdr9)
Available
Gene Name	Hsd17b13
Alternative Names	Alcohol dehydrogenase PAN1B-like (Short-chain dehydrogenase/reductase 9) (17-beta-HSD 13) (Scdr9)
Uniprot	Q8VCR2
Source	Baculovirus
Expression Region	20-304aa
AA Sequence	ESLVKFFIPRRRKSVTGQTVLITGAGHGIGRLTAY EFAKQKSRLVLWDINKRGVEETADKCRKLGAVVHV FVVDCSNRAEIYNSVDQVKREVGDVEIVVNNAGAI YPADLLSAKDEEITKTFEVNILGHFWIIKALLPSM LRRNSGHIVTVASVCGHGVIPYLIPYCSSKFAAVG FHRALTAELDTLGKTGIQTSCLCPVFVNTGFTKNP STRLWPVLEPEEVARSLINGILTNKKMIFVPSYIN ISLILEKGPGFSSKHPHGGSQQPVTPIPGDLTPSS DFLKH
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	35.1 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Subcellular location	Secreted
Protein Families	Short-chain dehydrogenases/reductases (SDR) family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer