Comparison

Recombinant Mouse Interleukin-33 (Il33), partial (Active)

Item no. BM-RPC26871-50ug
Manufacturer Biomatik
Amount 50ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin 33, IL-33, IL33, C9orf26, NKHEV, Interleukin-1 family member 11, DVS27, NF-HEV and IL- 1F11
Similar products IL-33, IL33, C9orf26, Interleukin-1 family member 11, DVS27, Interleukin 33, NKHEV, NF-HEV and IL- 1F11
Available
Gene Name
Il33
Alternative Names
Interleukin 33, IL-33, IL33, C9orf26, NKHEV, Interleukin-1 family member 11, DVS27, NF-HEV and IL- 1F11
Uniprot
Q8BVZ5
Source
E.coli
Expression Region
109-266aa
AA Sequence
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVIN VDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKK LMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPE QAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLAL VEEKDESCNNIMFKLSKI
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
17.6 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The activity is as determined by its binding ability in a functional ELISA. Immobilized recombinant mouse IL33 at 5 ug/mL can bind mouse IL1RL1 with a linear range of 0.625-5ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Mouse Interleukin 33 (IL-33) is a 30 kDa proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is constitutively expressed in smooth muscle and airway epithelia. IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. It is up?regulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL-1 alpha or IL?1 beta stimulation. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal organs.
Function
Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.; FUNCTION
Subcellular location
Nucleus, Chromosome, Cytoplasmic vesicle, secretory vesicle, Secreted
Protein Families
IL-1 family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close