« Back
Home /
Histone-lysine N-methyltransferase SMYD3(SMYD3), Human (His-Myc)

Histone-lysine N-methyltransferase SMYD3(SMYD3), Human (His-Myc)

Item no.	HY-P700258-1ea
Manufacturer	MedChem Express
Amount	1 ea
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Sequence	MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRD
Smiles	MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Histone-lysine N-methyltransferase SMYD3(SMYD3) Protein, Human (His-Myc),Human,E. coli
Shipping condition	Room temperature
Available
Manufacturer - Type	Recombinant Proteins
Shipping Temperature	Room temperature
Molecular Weight	56.5 kDa
Product Description	SMYD3 Protein, a histone methyltransferase, specifically induces di- and tri-methylation of H3K4, avoiding monomethylation, and methylates H4K5. Crucial in transcriptional activation within an RNA polymerase complex, SMYD3 also exhibits DNA-binding affinity for sequences containing 5'-CCCTCC-3' or 5'-GAGGGG-3'. Histone-lysine N-methyltransferase SMYD3 (SMYD3) Protein, Human (His-Myc) is the recombinant human-derived Histone-lysine N-methyltransferase SMYD3(SMYD3) protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. Histone-lysine N-methyltransferase SMYD3 (SMYD3) Protein, Human (His-Myc), has molecular weight of 56.5 kDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1 ea

available

Request delivery time