Comparison

Histone-lysine N-methyltransferase SMYD3(SMYD3), Human (His-Myc) European Partner

Item no. HY-P700258-1ea
Manufacturer MedChem Express
Amount 1 ea
Category
Type Proteins Recombinant
Specific against other
Sequence MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRD
Smiles MEPLKVEKFATAKRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Histone-lysine N-methyltransferase SMYD3(SMYD3) Protein, Human (His-Myc),Human,E. coli
Shipping condition Room temperature
Available
Manufacturer - Type
Recombinant Proteins
Shipping Temperature
Room temperature
Molecular Weight
56.5 kDa
Product Description
SMYD3 Protein, a histone methyltransferase, specifically induces di- and tri-methylation of H3K4, avoiding monomethylation, and methylates H4K5. Crucial in transcriptional activation within an RNA polymerase complex, SMYD3 also exhibits DNA-binding affinity for sequences containing 5'-CCCTCC-3' or 5'-GAGGGG-3'. Histone-lysine N-methyltransferase SMYD3 (SMYD3) Protein, Human (His-Myc) is the recombinant human-derived Histone-lysine N-methyltransferase SMYD3(SMYD3) protein, expressed by E. coli , with N-10*His, C-Myc labeled tag. Histone-lysine N-methyltransferase SMYD3 (SMYD3) Protein, Human (His-Myc), has molecular weight of 56.5 kDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 ea
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close