« Back
Home /
Glutamine Synthetase Recombinant Protein

Glutamine Synthetase Recombinant Protein

Item no.	PRS-91-970-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Microglia Markers Oligodendrocyte Markers
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice	Yes
Sequence	TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNF
NCBI	GLUL
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Glutamine Synthetase, GS, Glutamate Decarboxylase, Glutamate--Ammonia Ligase, GLUL, GLNS
Available
Manufacturer - Applications	This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag	C-6 His tag
Storage Conditions	Store at -20°C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight	43.13 kD
Background	Glutamine Synthetase reglutes intracellular concentration of glutamate. Glutamine Synthetase catalyzes the synthesis of glutamine from glutamate and ammonia. Glutamine is an important source of energy and that takes part in cell prolifetation, inhibition of apoptosis, and cell signaling. Glutamine Synthetase is expressed during early fetal stages, and has a role in maintaining body PH by removing ammonia from circulation. Mutations in the GLUL gene are related to congenital glutamine deficiency.
Protein Gi #	20149322
Buffer	Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name	glutamate-ammonia ligase
NCBI Organism	Homo sapiens
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 15 days

Compare

Add to wishlist

Get an offer