Comparison

Recombinant Human TNFSF13/APRIL/CD256 Protein European Partner

Item no. RP01120-10ug
Manufacturer Abclonal
Amount 10 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 90% by SDS-PAGE.
Sequence KKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL
NCBI TNFSF13/APRIL/CD256
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias TNFSF13,APRIL,CD256,TALL-2,TALL2,TNLG7B,TRDL-1,UNQ383/PRO715,ZTNF2
Similar products APRIL, TNFSF13, CD256, TRDL-1, TALL-2, A proliferation-inducing ligand, TNF-related death ligand 1, Tumor necrosis factor ligand superfamily member 13, TNFand APOL-related leukocyte expressed ligand 2
Shipping Condition Cool pack
Available
Manufacturer - Category
Bio-Markers & CD Antigens, TNF family
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Human TNFSF13/APRIL/CD256 Protein is produced by Mammalian expression system. The target protein is expressed with sequence (Lys112-Leu250) of human APRIL (Accession #O75888) fused with a Flag, 6xHis tag at the N-terminus.
Background
This protein is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
Immunogen
Lys112-Leu250
Route
N-Flag&His
Endotoxin
< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Bio-Markers & CD Antigens, TNF family
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close