Comparison

SARS-CoV-2 Spike Glycoprotein B.1.1.529-Omicron European Partner

Item no. RP30121-2
Manufacturer GenScript
Amount 2 vials (25 ug/peptide)
Quantity options 2 vials (25 ug/peptide) 2 vials (25 ug/peptide)
Category
Type Proteins
Specific against other
Source Severe Acute Respiratory Syndrome-related coronavirus 2 (Spike B.1.1.529) Spike glycoprotein (covering the following mutations: A67V, H69-, V70-, T95I, G142-, V143-, Y144-, Y145D, N211-, L212I, "EPE" insertion between 214R and 215D, G339D, S371L, S373P, S
Purity Crude (Major peak by ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each individual peptide).
Sequence MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHVISGTNGTKRFDNPVLPFNDGVYFASIEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLDHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPIIVREPEDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGW
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Country of Origin
USA
Storage Conditions
Store at -20°C.
Length
1270 aa

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2 vials (25 ug/peptide)
Available: In stock
available

Delivery expected until 11/20/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close