« Back
Home /
Anti-TYRO3 Antibody

Anti-TYRO3 Antibody

Item no.	101-11876
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Antibodies Western Blot ELISA Primary Antibodies By Organ Colorectal Cancer RNAi
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, RNAi
Clone	Monoclonal
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQL YIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQ PVWLTVEGVPFFTVEPKDLAV
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	TYRO3
Shipping condition	Cool pack
Available
Specificity	Human
Manufacturer - Category	Antibodies\|Primary Antibodies
Shipping Temperature	Blue ice
Storage Conditions	-20°C
Expiration	12 months from the date of shipment when stored properly.
Format	In 1x PBS, pH 7.2
Gene Symbols	TYRO3
Protein Name & Synonyms	TYRO3
UNSPSC Code	12352203
Manufacturer - Specificity	Human
Buffers	1x PBS, pH 7.2
Clonality	Monoclonal

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

101-11876.pdf

101-11876-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 7/31/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Recommend by mail