« Back
Home /
Recombinant Human uPAR/PLAUR/CD87 Protein

Recombinant Human uPAR/PLAUR/CD87 Protein

Item no.	RP00658LQ-100ug
Manufacturer	Abclonal
Amount	100 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE;> 95% by HPLC
NCBI	uPAR/PLAUR
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	U-PAR,uPAR,CD87,PLAUR,MO3,UPAR
Available
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method
Manufacturer - Category	Proteins
Storage Conditions	Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight	58.2 kDa
Description	Recombinant Human uPAR/PLAUR/CD87 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Gly305) of Human uPAR/PLAUR/CD87 (Accession #Q03405-1) fused with a C-hFc tag at the C-terminus.
Background	The receptor (u-PAR) for urokinase plasminogen activator (u-PA) is a three-domain protein, GPI-anchored to the cell surface, which focuses the enzymatic activity of u-PA, and allows the cell surface activation of plasminogen.Regulation of the activity of u-PA is also mediated by u-PAR.
Immunogen	Leu23-Gly305
Route	C-hFc
Manufacturer - Research Area	Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq	LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG
Protein Formulation	Supplied as 0.22 μm filtered solution in PBS (pH 7.4).
Expected Protein Size	58.2 kDa
Gene Symbol	uPAR/PLAUR

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

RP00658LQ-100ug-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 2/5/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer