Comparison

Beta-Amyloid (1-40), NH4OH

Item no. RPE-A-1157-02
Manufacturer rPeptide
Amount 250 ug
Quantity options 250 ug 250 ug 0.5 mg 1.0 mg
Category
Type Peptides
Specific against other
Purity >97%
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Storage Conditions
–20C
Description
Beta-amyloid peptide (Abeta), the major constituent of amyloid plaques in the brains of Alzheimer's patients, is thought to be the cause of Alzheimer's Disease (AD)1-3. AD is the most common neurodegenerative disease and afflicts about 10% of the population over 604. Using a proprietary production technique that limits the peptide's conformational changes, rPeptide has produced an ammonium hydroxide beta amyloid counter-ion. The Abeta ammonium hydroxide product can be utilized for in vitro aggregation experiments as well as cell based assays.
Molecular Mass
4329.9 Da
Territory
4329.9 Da

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 250 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close