« Zurück
Startseite /
ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb

ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb

ArtNr	A23737-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	100 ul 20 ul
Applikationen	FC, IF, ICC
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
NCBI	NCR3
Alias	NCR3,1C7,CD337,LY117,MALS,NKp30,natural cytotoxicity triggering receptor 3
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	IF/ICC, FC (intra)
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 594. Ex:588nm. Em:604nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Background	The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1).
Protein Size	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Route	Recombinant protein
Manufacturer - Research Area	Immunology & Inflammation, CD markers, Stem Cells, Hematopoietic Progenitors.
Antigen Seq	LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Manufacturer - Gene ID (Human)	259197
Expected Protein Size	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Gene Symbol	NCR3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A23737-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern