« Back
Home /
ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb

ABflo® 594 Rabbit anti-Human CD337/NKp30 mAb

Item no.	A23737-20ul
Manufacturer	Abclonal
Amount	20 ul
Quantity options	100 ul 20 ul
Applications	FC, IF, ICC
Specific against	Human (Homo sapiens)
Isotype	IgG
Purity	Affinity purification
NCBI	NCR3
Alias	NCR3,1C7,CD337,LY117,MALS,NKp30,natural cytotoxicity triggering receptor 3
Shipping Condition	Cool pack
Available
Manufacturer - Applications	IF/ICC, FC (intra)
Manufacturer - Category	Monoclonal Antibodies
Manufacturer - Conjugate / Tag	ABflo® 594. Ex:588nm. Em:604nm.
Shipping Temperature	ice pack
Storage Conditions	Store at 2-8°C. Avoid freeze.\|Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Protein Weight	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Background	The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.
Manufacturer - Cross Reactivity	Human
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-135 of human CD337/NKp30 (NP_667341.1).
Protein Size	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Route	Recombinant protein
Manufacturer - Research Area	Immunology & Inflammation, CD markers, Stem Cells, Hematopoietic Progenitors.
Antigen Seq	LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG
Manufacturer - Gene ID (Human)	259197
Expected Protein Size	16kDa/17kDa/18kDa/19kDa/20kDa/21kDa
Gene Symbol	NCR3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

A23737-20ul-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ul

available

Delivery expected until 9/4/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer