MT-ND5 Rabbit pAb

ArtNr	A8135-500uL
Hersteller	Abclonal
Menge	500 uL
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	IALELNNLTMKLSMNKANPYSSFSTLLGFFPSIIHRITPMKSLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTLTTNQKGLIKLYFMSFLINIILIIILYSINLE
NCBI	mt-Nd5
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	ND5, MT-ND5
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	Contributes to NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Is expressed in central nervous system; heart; liver; metanephros; and retina. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and MELAS syndrome. Orthologous to human MT-ND5 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5).
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 500-607 of mouse MT-ND5 (NP_904338.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200
Protein Size	67kDa
Route	Synthetic peptide
Manufacturer - Research Area	Cancer, Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Mitochondrial markers, Neuroscience, Neurodegenerative Diseases

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A8135-500uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 uL

lieferbar

Lieferung vsl. bis 04.09.2025