Vergleich

MT-ND5 Rabbit pAb Europäischer Partner

ArtNr A8135-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence IALELNNLTMKLSMNKANPYSSFSTLLGFFPSIIHRITPMKSLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTLTTNQKGLIKLYFMSFLINIILIIILYSINLE
NCBI mt-Nd5
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias ND5, MT-ND5
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background
Contributes to NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Is expressed in central nervous system; heart; liver; metanephros; and retina. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Leigh disease; and MELAS syndrome. Orthologous to human MT-ND5 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 5).
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-607 of mouse MT-ND5 (NP_904338.1).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:50 - 1:200
Protein Size
67kDa
Route
Synthetic peptide
Manufacturer - Research Area
Cancer, Signal Transduction, Endocrine & Metabolism, Mitochondrial metabolism, Mitochondrial markers, Neuroscience, Neurodegenerative Diseases

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 04.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen