B-cell Activating Factor Receptor Human Recombinant

Lyophilized powder at room temperature.

B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques.
Amino Acid Sequence:MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Physical Appearance and Stability: Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4C between 2-7 days and for future use below -18C.Please prevent freeze-thaw cycles.
Formulation and Purity: Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl. Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MO-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity: Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 ug/ml in the presence of 1.0ug/ml of human soluble BAFF.