Comparison

B-cell Activating Factor Receptor Human Recombinant

Item no. ANG-rAP-0345-10ug
Manufacturer Angio-Proteomie
Amount 10 ug
Quantity options 1000 ug 10 ug 1 ea 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
Shipping Condition Room temperature
Available
Shipping Temperature
Lyophilized powder at room temperature.
Usage statement
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Description
B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.The BAFF-R is purified by proprietary chromatographic techniques.
Amino Acid Sequence:MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Physical Appearance and Stability: Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4C between 2-7 days and for future use below -18C.Please prevent freeze-thaw cycles.
Formulation and Purity: Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl. Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MO-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity: Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 ug/ml in the presence of 1.0ug/ml of human soluble BAFF.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close