West Nile Virus Pre-M Recombinant

Description: The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.
Amino Acid Sequence:MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Physical Appearance and Stability: WNV Pre-M although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
Formulation and Purity: 20mM phosphate buffer pH 7.5. Protein is > 95% pure as determined by SDS-PAGE.
Application: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Biological Activity:
Shipping Format and Condition: Lyophilized powder at room temperature.
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.