Vergleich

West Nile Virus Pre-M Recombinant

ArtNr ANG-rAP-5505-100ug
Hersteller Angio-Proteomie
Menge 100 ug
Quantity options 1000 ug 100 ug 1 ea 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Lieferbar
Description
Description: The E.Coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.
Amino Acid Sequence:MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE.
Physical Appearance and Stability: WNV Pre-M although stable at 4C for 1 week, should be stored below -18C. Please prevent freeze thaw cycles.
Formulation and Purity: 20mM phosphate buffer pH 7.5. Protein is > 95% pure as determined by SDS-PAGE.
Application: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems.
Biological Activity:
Shipping Format and Condition: Lyophilized powder at room temperature.
Usage Statement: Our products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen