Vergleich

DcR1/CD263 Rabbit mAb Europäischer Partner

ArtNr A24912-200uL
Hersteller Abclonal
Menge 200 uL
Quantity options 100 uL 200 uL 20 uL 50 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, FC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP
NCBI TNFRSF10C
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias TNFRSF10C, CD263, DCR1, DCR1-TNFR, LIT, TRAIL-R3, TRAILR3, TRID, TNF receptor superfamily member 10c, DcR1/CD263
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 26-235 of human DcR1/CD263 (NP_003832.3).
Recommended Dilution
WB, 1:1000 - 1:5000|IHC-P, 1:50 - 1:200|FC, 1:100-1:500
Protein Size
27kDa
Route
Recombinant protein
Manufacturer - Research Area
Cell Biology & Developmental Biology, Apoptosis, Immunology & Inflammation, CD markers, Cytokines, NF-kB Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway,

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen