« Zurück
Startseite /
Phospho-SRC Family-Y416 Rabbit mAb

Phospho-SRC Family-Y416 Rabbit mAb

ArtNr	AP1370-20uL
Hersteller	Abclonal
Menge	20 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies Antibody
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGL
NCBI	Src Family
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	ASV,SRC1,THC6,c-SRC,p60-Src,SRC,Phospho-SRC Family-Y416
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Phosphorylated Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	60kDa
Background	This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic phosphorylated peptide around Y416 of human SRC Family (NP_005408.1).
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	60kDa
Route	Synthetic peptide
Manufacturer - Research Area	Epigenetics & Nuclear Signaling, Cancer, Signal Transduction, G protein signaling, G2/M DNA Damage Checkpoint, Kinase, Tyrosine kinases, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Inhibition of Apoptosis, Cell Adhesion, Gap Junctions, Cytoskeleton, Microtubules, Actins, Wnt/β-Catenin Signaling Pathway, Immunology & Inflammation, IL-6 Receptor Signaling Pathway, Cardiovascular, Angiogenesis, Protein phosphorylation.
Antigen Seq	NEYTAR
Manufacturer - Gene ID (Human)	2534/3055/3932/4067/6714/7525
Expected Protein Size	60kDa
Gene Symbol	Src Family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

AP1370-20uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 uL

lieferbar

Lieferung vsl. bis 11.09.2025