Vergleich

Phospho-SRC Family-Y416 Rabbit mAb Europäischer Partner

ArtNr AP1370-50uL
Hersteller Abclonal
Menge 50 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence TDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGL
NCBI Src Family
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias ASV,SRC1,THC6,c-SRC,p60-Src,SRC,Phospho-SRC Family-Y416
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Phosphorylated Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
60kDa
Background
This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic phosphorylated peptide around Y416 of human SRC Family (NP_005408.1).
Recommended Dilution
WB, 1:100 - 1:500
Protein Size
60kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics & Nuclear Signaling, Cancer, Signal Transduction, G protein signaling, G2/M DNA Damage Checkpoint, Kinase, Tyrosine kinases, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Inhibition of Apoptosis, Cell Adhesion, Gap Junctions, Cytoskeleton, Microtubules, Actins, Wnt/β-Catenin Signaling Pathway, Immunology & Inflammation, IL-6 Receptor Signaling Pathway, Cardiovascular, Angiogenesis, Protein phosphorylation.
Antigen Seq
NEYTAR
Manufacturer - Gene ID (Human)
2534/3055/3932/4067/6714/7525
Expected Protein Size
60kDa
Gene Symbol
Src Family

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 11.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen