« Zurück
Startseite /
Recombinant Human Keratin, type II cytoskeletal 4(KRT4)

Recombinant Human Keratin, type II cytoskeletal 4(KRT4)

ArtNr	CSB-EP012556HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSM SGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQ GACFGGAGGFGTGGFGAGGFGAGFGTGGFGGGFGG SFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEI DPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQ NKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLR KQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEI NKR
Protein Familie	Intermediate filament family
Citations	Wanner R., Tilmans I., Mischke D.Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Cytokeratin-4 ;CK-4Keratin-4 ;K4Type-II keratin Kb4
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	73.3 kDa
General Research Areas	Signal Transduction
Expression Region	1-534aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tissue Specificity	Detected in the suprabasal layer of the stratified epithelium of the esophagus, exocervix, vagina, mouth and lingual mucosa, and in cells and cell clusters in the mucosa and serous gland ducts of the esophageal submucosa (at protein level). Expressed widely in the exocervix and esophageal epithelium, with lowest levels detected in the basal cell layer.
Involvement in disease	White sponge nevus 1 (WSN1)
Gene Names	KRT4
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP012556HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern