« Zurück
Home /
Recombinant Human Prostate stem cell antigen(PSCA)

Recombinant Human Prostate stem cell antigen(PSCA)

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer Gastric Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	50ug
Host	E.coli
ArtNr	CSB-EP018840HU-50
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cancer
Uniprot ID	O43653
Gene Names	PSCA
Organism	Homo sapiens (Human)
AA Sequence	LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRA VGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTD LCNAS
Expression Region	21-95aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	35.2 kDa
Relevance	May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.
Reference	Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer.The study group of millennium genome project for cancerSakamoto H., Yoshimura K., Saeki N., Katai H., Shimoda T., Matsuno Y., Saito D., Sugimura H., Tanioka F., Kato S., Matsukura N., Matsuda N., Nakamura T., Hyodo I., Nishina T., Yasui W., Hirose H., Hayashi M. , Toshiro E., Ohnami S., Sekine A., Sato Y., Totsuka H., Ando M., Takemura R., Takahashi Y., Ohdaira M., Aoki K., Honmyo I., Chiku S., Aoyagi K., Sasaki H., Ohnami S., Yanagihara K., Yoon K.-A., Kook M.-C., Lee Y.-S., Park S.R., Kim C.G., Choi I.J., Yoshida T., Nakamura Y., Hirohashi S.Nat. Genet. 40:730-740(2008)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity	Highly expressed in prostate (basal, secretory and neuroendocrine epithelium cells). Also found in bladder (transitional epithelium), placenta (trophoblasts), stomach (neuroendocrine cells), colon (neuroendocrine cells) and kidney (collecting ducts). Overexpressed in prostate cancers and expression is correlated with tumor stage, grade and androgen-independence. Highly expressed in prostate cancer bone metastases. Expressed in gastric epithelial cells, mainly in the isthmus (at protein level). Not detected in normal intestinal epithelium (at protein level). Expressed in brain cortex; expression is significantly increased in the front cortex of Alzheimer disease patients.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP018840HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen