Comparison

Recombinant Human Prostate stem cell antigen(PSCA)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018840HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRA VGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTD LCNAS
Research Topic
Cancer
Uniprot ID
O43653
Gene Names
PSCA
Tag Info
N-terminal GST-tagged
Expression Region
21-95a
MW of Fusion Proten
35, 2
Sequence Info
Full Length
Relevance
May be involved in the regulation of cell proliferation. Has a cell-proliferation inhibition activity in vitro.
Reference
Genetic variation in PSCA is associated with susceptibility to diffuse-type gastric cancer.The study group of millennium genome project for cancerSakamoto H., Yoshimura K., Saeki N., Katai H., Shimoda T., Matsuno Y., Saito D., Sugimura H., Tanioka F., Kato S., Matsukura N., Matsuda N., Nakamura T., Hyodo I., Nishina T., Yasui W., Hirose H., Hayashi M. , Toshiro E., Ohnami S., Sekine A., Sato Y., Totsuka H., Ando M., Takemura R., Takahashi Y., Ohdaira M., Aoki K., Honmyo I., Chiku S., Aoyagi K., Sasaki H., Ohnami S., Yanagihara K., Yoon K.-A., Kook M.-C., Lee Y.-S., Park S.R., Kim C.G., Choi I.J., Yoshida T., Nakamura Y., Hirohashi S.Nat. Genet. 40:730-740(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close